Protein Info for LRK53_RS06855 in Rhodanobacter sp000427505 FW510-R12

Annotation: protein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 273 to 300 (28 residues), see Phobius details PF07549: Sec_GG" amino acids 33 to 59 (27 residues), 30 bits, see alignment (E = 2.8e-11) TIGR00966: protein-export membrane protein SecF" amino acids 38 to 292 (255 residues), 234.2 bits, see alignment E=1.9e-73 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 97 to 289 (193 residues), 168.5 bits, see alignment E=1.8e-53 PF02355: SecD_SecF_C" amino acids 117 to 300 (184 residues), 201.8 bits, see alignment E=7.3e-64

Best Hits

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 48% identity to psu:Psesu_1868)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>LRK53_RS06855 protein translocase subunit SecF (Rhodanobacter sp000427505 FW510-R12)
MEIFNHDSNIHFLGMRKYTIAIGIFLMVASIGLIMFRGLNYGLDFTGGVSMIVDYGQSVE
ISEVRNALEKGGIDNAMVQSMGGTREVSIRLQPKDDPGAVDANGKFNLDRIAADVIKVLQ
VARPDAKLKSRDYVSAQVGQELRSDGTVAAVFVILGIMFYLWIRFERRFAIAAVITEVHD
TLVTLGILALVQREFDMTVLASVLAVIGYSINDKVVVFDRIRELFRLARKAEPEEILNRS
INNTLSRTIITSLFTGITMGALYFFGGTAVHGFAVTMLIGIVVGTLSSIFVASPILLWLG
VSKKDLMPVTKENPELARRP