Protein Info for LRK53_RS06665 in Rhodanobacter sp000427505 FW510-R12

Annotation: outer membrane protein assembly factor BamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 806 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 23 to 806 (784 residues), 814.5 bits, see alignment E=4.7e-249 PF07244: POTRA" amino acids 24 to 90 (67 residues), 23.4 bits, see alignment E=1.2e-08 amino acids 92 to 171 (80 residues), 49.1 bits, see alignment E=1.2e-16 amino acids 175 to 262 (88 residues), 52.1 bits, see alignment E=1.3e-17 amino acids 265 to 343 (79 residues), 52.8 bits, see alignment E=8e-18 amino acids 346 to 419 (74 residues), 62 bits, see alignment E=1.1e-20 PF01103: Omp85" amino acids 447 to 806 (360 residues), 230.6 bits, see alignment E=5.3e-72

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 50% identity to smt:Smal_1257)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (806 amino acids)

>LRK53_RS06665 outer membrane protein assembly factor BamA (Rhodanobacter sp000427505 FW510-R12)
MKRIAALILLASLSANAFAFDPFVVSDIRIDGLSRISAGTVYNYLPINKGDQLTNDGAQR
AIRALYRTKFFSDVEFEREGSILVIKVVERPSIAKLTLRGNKDIKTDDLKKGLKEIGLTE
GETFDRLALDNVQQELTRQYYNRGKYNVSVDPHVTRLDRNRVAVEIEIREGKAAKIKELN
ILGNHAFTNKQIRKNFESDTTNWMSWYSKDDQYSREKLSGDLEKLQSYYMDRGYADFGVD
STQVAIAPDKRAMYIDASIKEGEIYKVADVKLLGDLILPEATMRQLVFVKSGETFNRAAV
EASTKAIKAILANIGYAYAKVTPIPKLDKEKRTVDLTLYVEPGQRVYVRRVVFQGNTRTE
DDVLRREMRQLEGTWYNQAAVDRSKVRLQRLGYFKKVDIDQKMVPGTQDKVDVTVKVEEQ
SAGSMQFGIGYSQYSGIILNASVSQNNLFGTGDSFSISGERSTYYTRLGLNYYNPYLTDS
GIGIGYSASYSKTDYGNTDFANYATSAKSFSTYLGIPISETDGLRVGLGVSSNNVNLFQG
YSPEVLLDYQNEIGNKTIHTWTGTLGWNHDTRNSYWAPTRGGLISASTDVALPGSTVQYW
KLNTEINHYWPIGKGFVLYLDGQVGYGKTYGGNGISDDAFAALKSASLAQNPNHVLTDMR
QDLPFWQNFYAGGVRDVRGYQDNTLGPRVCIDGSAPDAKGTCNNGAYYSQPIGGAFKVLG
TAQVFLPLPFLKDVNTARVSWFMDVGNVYKDYKSFDASELRASTGLSLQWQAPIGPLIIS
FAMPLRSKAADRNYEERIQFTFGSQF