Protein Info for LRK53_RS06655 in Rhodanobacter sp000427505 FW510-R12

Annotation: 3-hydroxyacyl-ACP dehydratase FabZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR01750: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ" amino acids 12 to 152 (141 residues), 186.7 bits, see alignment E=9e-60 PF22817: ApeP-like" amino acids 16 to 150 (135 residues), 49.2 bits, see alignment E=6.8e-17 PF07977: FabA" amino acids 21 to 147 (127 residues), 123.4 bits, see alignment E=8e-40 PF22818: ApeI-like" amino acids 42 to 125 (84 residues), 57 bits, see alignment E=2.6e-19

Best Hits

Swiss-Prot: 58% identical to FABZ_BORPD: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (fabZ) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] (inferred from 59% identity to smt:Smal_1255)

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 4.2.1.59

Use Curated BLAST to search for 4.2.1.- or 4.2.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>LRK53_RS06655 3-hydroxyacyl-ACP dehydratase FabZ (Rhodanobacter sp000427505 FW510-R12)
MSEQGDFMTLPINVEQILELLPHRYPFLLVDRVVEIVPDVSVVALKNVTINEPFFQGHFP
SHPVMPGVLIIEAMAQTAGLLTQLSRHFKGDKGSPLFYLVKVDNARFSAPVVPGDQLRFE
VNQKRLMRGMGLFAARSLVDGKEVASCELMCAARAGK