Protein Info for LRK53_RS06540 in Rhodanobacter sp000427505 FW510-R12

Annotation: ribonuclease G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 TIGR00757: ribonuclease, Rne/Rng family" amino acids 13 to 432 (420 residues), 496 bits, see alignment E=4.5e-153 PF00575: S1" amino acids 38 to 109 (72 residues), 27.2 bits, see alignment E=6.1e-10 PF10150: RNase_E_G" amino acids 124 to 399 (276 residues), 346.7 bits, see alignment E=1.4e-107 PF20833: RNase_E_G_Thio" amino acids 410 to 492 (83 residues), 37.3 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: K08301, ribonuclease G [EC: 3.1.26.-] (inferred from 69% identity to xal:XALc_2460)

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.-

Use Curated BLAST to search for 3.1.26.- or 3.1.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>LRK53_RS06540 ribonuclease G (Rhodanobacter sp000427505 FW510-R12)
MSEEILINVTPRETRVGVVENGMLQEVHVERASRRGYVGNIYKGRVQRVMPGMQAVFVEI
GLERAAFLHASDIVRPTPADGAETNGNGHLPSISELVHEGQEIVVQVVKDPISTKGARLS
AHLSIPSRYLVLLPYARTLGISARIEDEAERQRLREVLTPLIGDDASGNSRLGYIVRTNA
EGQSAESLAFDVTYLGKVWRVVQENIAKAKVGERVYEELSLPLRSLRDMLNEDIEKVRVD
SRDTFEKVTHFVHKFMPNLDDRIEHYDGERPIFDLYGVEDEMQRALKKEVPLKSGGYLIV
DQTEAMTTIDVNTGAYLGSRNLEETVYRTNLEAAQAAARQLRLRNLGGIVIIDFIDMSDE
EHKRQVLRMLSKGLARDHAKTTVYPMSALGLVEMTRKRTTESLARQLCEPCPACNGRGVQ
KTAETVTYEIFREITRAVRQFNARKLLVMANPAVVNRILEEESGAVAELEEFISKSIRFQ
AEEHYSQEQFDVVLL