Protein Info for LRK53_RS06530 in Rhodanobacter sp000427505 FW510-R12

Annotation: mismatch-specific DNA-glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF03167: UDG" amino acids 12 to 153 (142 residues), 59 bits, see alignment E=3e-20

Best Hits

KEGG orthology group: K03649, TDG/mug DNA glycosylase family protein [EC: 3.2.2.-] (inferred from 59% identity to aex:Astex_3480)

Predicted SEED Role

"G:T/U mismatch-specific uracil/thymine DNA-glycosylase" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>LRK53_RS06530 mismatch-specific DNA-glycosylase (Rhodanobacter sp000427505 FW510-R12)
MPRRTERHVLPDLLQPGLALVFCGTAAGRRSAAERAYYAHPGNLFWRALHASGLTPRLLV
PAEFPLLPQFGIGLTDLAKRHSGNDDELPPDAFDAPALFARIERHAPRLLAFTSKNAARS
ALGHAVGYGLQDETLGSTRLFVLPSPSGQARGHWDLAPWLALAELFHAARAGM