Protein Info for LRK53_RS06505 in Rhodanobacter sp000427505 FW510-R12

Annotation: 3-deoxy-7-phosphoheptulonate synthase class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF01474: DAHP_synth_2" amino acids 14 to 447 (434 residues), 633.3 bits, see alignment E=8.3e-195 TIGR01358: 3-deoxy-7-phosphoheptulonate synthase" amino acids 14 to 450 (437 residues), 683.2 bits, see alignment E=6.1e-210

Best Hits

Swiss-Prot: 49% identical to AROF_STRCO: Phospho-2-dehydro-3-deoxyheptonate aldolase (aroH) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 76% identity to sml:Smlt0937)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase II (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>LRK53_RS06505 3-deoxy-7-phosphoheptulonate synthase class II (Rhodanobacter sp000427505 FW510-R12)
MNPPVSDFHPAAGWAPDSWQQRVALQQPHYDDAAELAAAGAQLAQLPPLVTSWEVLALKQ
ALAEAQEGRRFLLQGGDCAESFADCTSPVISNRLKVLLQMSLVLVHGLKKPVLRVGRFAG
QYAKPRSADTETRDGVTLPSFRGDVVNSPEFTTAARRPDPQRLIQAHARSALTMNFVRAL
IDGGFADLHHPEYWDLAWVEHSPLAAEYRQMVTAIGDSLRFMETLAGSIAGFSKVDFFTS
HEALLLRYEQALTRQVPRHPGWFNLSTHFPWIGMRTAALDGAHVEYFRGIRNPVAVKVGP
SVTAEQLLPLIDALNPDDEPGRLTLIHRMGNAKIAAALPPLLAAVKREGRRVLWVADPMH
GNTESTSNGHKTRRFDNIRGELDQAFDIHAAAGTRLGGVHLELTGEDVTECMGGARDLSE
SDLDRAYKSMVDPRLNYEQSLELAMLIVRKSVNGQG