Protein Info for LRK53_RS06465 in Rhodanobacter sp000427505 FW510-R12
Annotation: 50S ribosomal protein L15
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to RL15_NITMU: 50S ribosomal protein L15 (rplO) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 62% identity to alv:Alvin_2344)MetaCyc: 54% identical to 50S ribosomal subunit protein L15 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (146 amino acids)
>LRK53_RS06465 50S ribosomal protein L15 (Rhodanobacter sp000427505 FW510-R12) MTIMRLNDIKPAAGSRKTRLRVGRGIGSGLGKTAGRGHKGQHARAGGTHKYGFEGGQMPL NRRMPKIGFRSKKQAESQEVFLYQLGHLKGDVIDVVALHQAGLINSRAKKVKVVLKGEIG RAVKLSGLLATAGAKAAIEAAGGSVE