Protein Info for LRK53_RS06455 in Rhodanobacter sp000427505 FW510-R12

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 16 to 168 (153 residues), 210 bits, E=8e-67
• PF00333: Ribosomal_S5
  • amino acids 17 to 80 (64 residues), 93.4 bits, E=6.7e-31
• PF03719: Ribosomal_S5_C
  • amino acids 93 to 162 (70 residues), 96 bits, E=7e-32

Best Hits

Swiss-Prot: 72% identical to RS5_STRMK: 30S ribosomal protein S5 (rpsE) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 82% identity to psu:Psesu_2318)

MetaCyc: 75% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Protein Sequence (173 amino acids)

>LRK53_RS06455 30S ribosomal protein S5 (Rhodanobacter sp000427505 FW510-R12)
MEKNMSSTDRENSDGLLEKLIAVNRVAKTVKGGRQMSFTALTVVGDGEGKVGFGYGKARE
VPVAISKAMERARRQMVNIELNNGTLWYAVKANHGAARVYMQPASEGTGVIAGGAMRAVL
EVVGVKNVLAKAVGSRNPINLVRATIRGLQAVASPKKIAAKRGKTLEEVLGNG