Protein Info for LRK53_RS06170 in Rhodanobacter sp000427505 FW510-R12

Annotation: TlpA family protein disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF08534: Redoxin" amino acids 29 to 157 (129 residues), 55.7 bits, see alignment E=1e-18 PF00578: AhpC-TSA" amino acids 32 to 143 (112 residues), 60.5 bits, see alignment E=3.2e-20

Best Hits

KEGG orthology group: None (inferred from 51% identity to xfm:Xfasm12_0984)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>LRK53_RS06170 TlpA family protein disulfide reductase (Rhodanobacter sp000427505 FW510-R12)
MTLFTSLCRSAAALAIALAFAIPVQAAMPAQPTLHVTTLDGRTFDLAAQRGKWVIVNYWA
TWCVPCIKEMPDISRFVAAHQNATAIGLAYEDSEPADIKAFLAKHPVVYPIAQVSLDQPL
KDFDEPRGLPTTYLINPDGKVAKHIVGPVTEASLEAIIGGK