Protein Info for LRK53_RS06155 in Rhodanobacter sp000427505 FW510-R12

Annotation: DUF2069 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details PF09842: DUF2069" amino acids 15 to 112 (98 residues), 77.6 bits, see alignment E=3.7e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>LRK53_RS06155 DUF2069 domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MNARPALPTEQRVGLFAWAALVTLQFAWHVWLFPPRTLPLWLVLALAVVPLLLPLLAIRD
VRRALLWVGILSLFYFCHGVSEAWSSAGERWLAVTEIVLTVLLIATLGAGVRRRRPASPP
TRD