Protein Info for LRK53_RS06005 in Rhodanobacter sp000427505 FW510-R12

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 370 to 386 (17 residues), see Phobius details amino acids 393 to 411 (19 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (671 amino acids)

>LRK53_RS06005 tetratricopeptide repeat protein (Rhodanobacter sp000427505 FW510-R12)
MHSRIAANSTIAVLSLLILTGLAYWHGLFGDFLFDDFTNLPALGASGPIDNWPAFWRYIT
SGTADPTGRPLTLLTFLLDAHDWPADPFPFKRGNLILHLLNGVLLYALLARLGRLLRHDD
RRRRTAALLGTTLWLLHPLLVSTTLYIVQREAMLPATYTLAGLLLWLHGRQLLAQGRTAV
GLGWSVLGLGGFTVLGVLAKANGALLPLFALLIEEIVLAPRHPVPDNKPRLAHRFALFAF
GVVPAVAILGYLLRTGLLGVLDGGPVGFRPWSVGQRLLTEPRVLLDYLQLLWLPRPFSSG
LFNDQYVASISWLQPITTLPAMLAVFGLIGLAWWQRRRYPALALAILFYFAGQLLESTSI
PLELYFEHRNYLPALLMFWPLGLWLANARKLRLLKYTLMLALPLGLAWITHTRAELWGNV
HSQALLWATINPNSARAQTNAAQIEMRAGQPQAAVRRLEKLLVDQPNQVQLAFNLIGARC
MIGGITADDLDAAKLAMQGTPNTGTLFANWFERTLPAAMSGGCPGLTAQGLQQLIDTGLD
NPKLSAAGPQQDLTYLRGKIALAQGRPDEALADFTRALNLQVRPGMALEAAATLGRAGYP
SHGLRLLDHYETVRGNAMKPGFGMPWLHAWVLEHQHYWPHELDHLRRQLALDARADSMNT
SGHTSPAGTSD