Protein Info for LRK53_RS05955 in Rhodanobacter sp000427505 FW510-R12

Annotation: DUF86 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF01934: HepT-like" amino acids 1 to 98 (98 residues), 97.3 bits, see alignment E=2.7e-32

Best Hits

KEGG orthology group: None (inferred from 60% identity to vei:Veis_1407)

Predicted SEED Role

"Predicted nucleotidyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>LRK53_RS05955 DUF86 domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MIEAIALARSYVEGMDKATFLADRRTQQAVIMNILVIGEAATKLADRYPGFTLTHPQIAW
NSMRGMRNRLAHGYFDINMDVVWETLERDLPGLQKSLTELSQQILRDN