Protein Info for LRK53_RS05620 in Rhodanobacter sp000427505 FW510-R12

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR01357: 3-dehydroquinate synthase" amino acids 18 to 356 (339 residues), 354.5 bits, see alignment E=3.1e-110 PF01761: DHQ_synthase" amino acids 71 to 182 (112 residues), 155.3 bits, see alignment E=4.6e-50 PF24621: DHQS_C" amino acids 184 to 328 (145 residues), 157.8 bits, see alignment E=1.8e-50

Best Hits

Swiss-Prot: 57% identical to AROB_XANC8: 3-dehydroquinate synthase (aroB) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 59% identity to psu:Psesu_0770)

MetaCyc: 49% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.3.4

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>LRK53_RS05620 3-dehydroquinate synthase (Rhodanobacter sp000427505 FW510-R12)
MNDPARQTVTVALGQRSYPVWIGAGLLHDHARWRAMLRGRHALVVSNTTVAPLYLPRIEA
GLDGLRWASFLLDDGEAHKSFANVGRVLEALGELGATRDACVIALGGGVVGDLAGFSAAC
WMRGIDFIQMPTTLLAMVDSSVGGKTGVNLPVGKNLAGAFHQPRAVVADIDTLATLPGRE
YRAGLAEVIKGAAIGDEPFFAWLEQHAAALAAREPATVQEAIARKVAYKAGVVARDETEQ
GERALLNLGHTFGHALETAGHYTALLHGEGVAIGMLLAARLSERLGMSAPAASTRLQRLL
EAVGLPMAVPPGMDPPQLLALMRLDKKNTAGTLRLILWRGIGRAEIVAGVAEADVLAVLT
EATSAP