Protein Info for LRK53_RS05535 in Rhodanobacter sp000427505 FW510-R12

Annotation: FtsX-like permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 286 to 313 (28 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 34 to 254 (221 residues), 40.9 bits, see alignment E=3e-14 PF02687: FtsX" amino acids 293 to 403 (111 residues), 54.5 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 52% identity to sml:Smlt4103)

Predicted SEED Role

"ABC transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>LRK53_RS05535 FtsX-like permease family protein (Rhodanobacter sp000427505 FW510-R12)
MELRPILSTLRRHKITSWLLILEIALTCAIVCNAVFMIGHRLQHMHMSSGIDEHALVKIQ
LAQIAPTPDIFVRAREDLAVLRQVPGVQAAALTNQLPMEGSSSNASLKLDPAQREPTLSA
GTYFGEDLPQTMGARLVAGRNLQPDEIVNADVVVKALASGNTKGLPAAVTVITQALADRL
WPGQSPLGKTIYLTDQVGVRVVGVLADLARANAYNDATAHYSVVLPLFMGVGRNQSYVVR
TRPQDREVVLKAAVAALKKADPERVVTQQRTYDELRGKFFANDRAMAGILVGVIVALLIV
TALGIAGLASFWVAQRRRTIGVRRALGATRGDILRYFQTENFLIVTGGIVLGMLLAFALN
LVLMQHYELPRLPLYYLPIGALLLWGLGQLAVLGPAMRAAAVPPVVATRSI