Protein Info for LRK53_RS05500 in Rhodanobacter sp000427505 FW510-R12

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 90 to 127 (38 residues), 28.3 bits, see alignment 1.7e-10 PF16576: HlyD_D23" amino acids 235 to 328 (94 residues), 33.5 bits, see alignment E=4e-12 PF13437: HlyD_3" amino acids 242 to 336 (95 residues), 35.8 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 48% identity to psu:Psesu_2489)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>LRK53_RS05500 efflux RND transporter periplasmic adaptor subunit (Rhodanobacter sp000427505 FW510-R12)
MIRDTSAQDRLVEVKPNRKRQLILLGAGVLVLALLAWLAPGVGRLFSASASVSSSRLAFA
TVERGPFVRDIAAEGKVVAAVSPTLYATSGGAVALKVHAGDTVKVGQVLATIVSPELTNK
LAQEQSNADAMEVGYRRAQIDARKQRSALQETYDNATIDQTTAERNLDRYQKAYAKGAVS
NMDVDKAKDALDKSKIATTHAKANLGLDNDSLNFDIQSKKLAHQRQLLLVKDLQRQVDDL
DVKSPVDGQVGQLFIAERATVAKDAQLLSVIDLSALQVEMQVPESFARDLGIGMAGEISG
NGHTWKGLVSAISPEVVNGQVAARLRFDGDTPKQLRQNQRLSVRVLLDRRDDVLTVQRGS
FVDESGGSYAYLVRDGIAKKTPIRVGASSIDKVEILDGLKEGERIVISGTDSFKGATTVA
ISN