Protein Info for LRK53_RS05490 in Rhodanobacter sp000427505 FW510-R12

Annotation: tetratricopeptide repeat-containing sulfotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 PF13432: TPR_16" amino acids 82 to 138 (57 residues), 19.6 bits, see alignment 7.5e-07 amino acids 182 to 245 (64 residues), 27.5 bits, see alignment E=2.6e-09 amino acids 223 to 279 (57 residues), 29.1 bits, see alignment 8.2e-10 amino acids 285 to 321 (37 residues), 16.1 bits, see alignment 9.4e-06 PF14559: TPR_19" amino acids 190 to 253 (64 residues), 36 bits, see alignment E=5.3e-12 PF13181: TPR_8" amino acids 280 to 311 (32 residues), 19.1 bits, see alignment (E = 8.4e-07) PF00685: Sulfotransfer_1" amino acids 418 to 613 (196 residues), 36.9 bits, see alignment E=2.1e-12 PF13469: Sulfotransfer_3" amino acids 420 to 611 (192 residues), 160.9 bits, see alignment E=4.2e-50

Best Hits

KEGG orthology group: None (inferred from 50% identity to nar:Saro_3035)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>LRK53_RS05490 tetratricopeptide repeat-containing sulfotransferase family protein (Rhodanobacter sp000427505 FW510-R12)
MTSAPAIGTLEQALAHAARLLERDPALAIGQLDEILQAAAGHPVALQLLAAARSLQGDLQ
GALDILVPLAQAQPAWAMVHADLGLALGRCGRGQEAIAALRRAVALKPDLPQAWRALGDH
LMAAGEQAAADAAYASHVRYSTRDPRLLAAAVALVENRIPEAETRLREHLKQAPTDVAAI
RMFAEVAARLGRNEDALHLLERCLELAPGFHEARRNYALLLHRANRPEQALAELARLLAA
DPEDAGSRNLKAAVLCRTGDYEQAIGIYAALLERHPDQPKLWVSQGHALKTAGHTERAIA
AYRRSLELEPSFGEVWWSLANLKTFRFGADELAAMRAQLARTDLAEDDRLHLEFAIGKAL
EDAGEYESSFRHYAQGNAIRRGQVHYSADDTSARVRYICAHYTREFFAARAGAGSPAPDP
IFVVGLPRAGSTLIEQILSSHSQVEGTMELPEVTSIARLLRMQGDADEAMPYHGALAALD
ADALRALGERYLEHTRIQRKTAAPLFIDKMPNNFMHIGLIQLMLPKAKIIDARRHPLACG
FSAFKQHFARGQGFSYELADIGRYYRDYVALMAHFDAVLPGRIHRVVYERMVEDTEGEVR
RLLDYCGLPFEASCLRFFQNPRPVRTASSEQVRQPIYREGVDHWRHYAAWLGPLASPLGP
VLQRYPDVPV