Protein Info for LRK53_RS05445 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphatidylglycerophosphatase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details PF04608: PgpA" amino acids 22 to 169 (148 residues), 148.4 bits, see alignment E=6.6e-48

Best Hits

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 50% identity to etr:ETAE_0978)

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>LRK53_RS05445 phosphatidylglycerophosphatase A (Rhodanobacter sp000427505 FW510-R12)
MSAKKTLSAGQRRALLATPAGWLACGFGSGLAPVAQGTFGSLAALLPWLLLRELPLPIYL
IVLLAGFGVGVWACNVAGRALGVDDHRSLVWDEFIGQWIALLPLLLPALLPAGGFAWWML
LAGFVLFRLFDVWKPWPIRWLDRRVKGGMGVMIDDVVAGVFAAIVLALALYPQR