Protein Info for LRK53_RS05255 in Rhodanobacter sp000427505 FW510-R12

Annotation: LysR substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 81.1 bits, see alignment E=4.7e-27 PF03466: LysR_substrate" amino acids 88 to 293 (206 residues), 166.4 bits, see alignment E=6e-53

Best Hits

Swiss-Prot: 41% identical to OXYR_MYCAV: Probable hydrogen peroxide-inducible genes activator (oxyR) from Mycobacterium avium

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 68% identity to xac:XAC0905)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>LRK53_RS05255 LysR substrate-binding domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MNLRDLQYLVALAEHRHFGRAAEACFVSQPTLSTQIKKLEDELGVSLVERTPRKVLLTEV
GRDIATRARDVLNEIEQIRGVARRTLDPESGTVRLGIFPTLGPYLLPHALPLVREAFPRL
ELLLVEEKTEVVLRMLREGKLDAGILALPLHEDSLHSEFLFEEPFLLAVSDAHPLAQHQG
QLKLGDLSSQNLLLLEDGHCLRDQALEVCHLTGAGEHSGFRATSLETLRQMVAANVGITL
LPVTAVKPPVAPVENLHLIEFRGHPPSRRIAMVWRKSSAMDGFLRRLADVFRQLPADLLD
AHTATTPAPAPRKAARR