Protein Info for LRK53_RS05115 in Rhodanobacter sp000427505 FW510-R12

Annotation: crossover junction endodeoxyribonuclease RuvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF02075: RuvC" amino acids 3 to 151 (149 residues), 155.6 bits, see alignment E=4.5e-50 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 3 to 155 (153 residues), 151.4 bits, see alignment E=9.8e-49

Best Hits

Swiss-Prot: 61% identical to RUVC_XANCP: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 61% identity to xca:xccb100_1170)

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>LRK53_RS05115 crossover junction endodeoxyribonuclease RuvC (Rhodanobacter sp000427505 FW510-R12)
MRIIGIDPGSQRTGVGIIDVDDAGRLAHVFHGALAVAGEATFPLRLKRIFDELCDIIAAH
RPTECGIERVFMARNPDSALKLGQARGAAICAVVSQGIVVHEYAATEVKQSVVGSGRGDK
TQVQHMIGVLLGLKGPLQADAADALAVAVAHAHTRASLARVGIPRTAWRRRR