Protein Info for LRK53_RS05110 in Rhodanobacter sp000427505 FW510-R12

Annotation: YebC/PmpR family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 6 to 236 (231 residues), 261.8 bits, see alignment E=3.3e-82 PF20772: TACO1_YebC_N" amino acids 7 to 72 (66 residues), 95.9 bits, see alignment E=1.6e-31 PF01709: Transcrip_reg" amino acids 79 to 236 (158 residues), 173.8 bits, see alignment E=2.3e-55

Best Hits

Swiss-Prot: 56% identical to Y1220_METCA: Probable transcriptional regulatory protein MCA1220 (MCA1220) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: None (inferred from 55% identity to psu:Psesu_0589)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>LRK53_RS05110 YebC/PmpR family DNA-binding transcriptional regulator (Rhodanobacter sp000427505 FW510-R12)
MGRGPSIEGRKNAEDARRAKVFTKLIREITVATRSGVADPGGNPRLRAAIDKALSANMTK
DTIERAVKRGSGAEGGADMQELRYEGYGPAGIALIIESFTDNPTRTVADVRYALTKHGGN
LGTSGSVAFQFTRCGELVFATGGDAAAEEKVLEAALEAGADDVLNEHGESIVLCTPEHFE
AVQQGLIAAGLNAQHAGVVMRPNNRVEVPEEALEQLLDLLERLDALDDVSEVSHNAALPA
AS