Protein Info for LRK53_RS05065 in Rhodanobacter sp000427505 FW510-R12

Annotation: NAD(P)-dependent alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 255 to 267 (13 residues), see Phobius details PF08240: ADH_N" amino acids 27 to 127 (101 residues), 41.1 bits, see alignment E=2.7e-14 PF00107: ADH_zinc_N" amino acids 170 to 290 (121 residues), 102.4 bits, see alignment E=2.8e-33 PF13602: ADH_zinc_N_2" amino acids 202 to 331 (130 residues), 64.2 bits, see alignment E=3.7e-21

Best Hits

KEGG orthology group: None (inferred from 72% identity to xac:XAC2896)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>LRK53_RS05065 NAD(P)-dependent alcohol dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MKAIHLRRPFGLEHLEYTDSADPGAPGAGKIRVRLHASSLNFHDLDVVLGRMPVEDGRIP
LSDGAGVVEAVGADVHEFAVGDHVVSTFYPQWLAGGPVAAGFAATPGDGIDGYAREAVVR
PATAFTHAPRGYSHVEAATLTTAGLTAWRALVVEGGLKIGDTVLALGTGGVSIFALQLAK
AAGATVIVTSSSEEKLARAAALGADYGINYRQHPEWSKQVLEITGGRGVDHVIEVGGPGT
LTQSMRSARVGGHIALIGALTGVADVVPTVELMLRQQRVSGIGVGNRQHQIALVRAIEAT
GIRPVIDRSFALRDMADAFRLQQAGGHFGKIGLDYAL