Protein Info for LRK53_RS05040 in Rhodanobacter sp000427505 FW510-R12

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 19 to 265 (247 residues), 252 bits, see alignment E=2.7e-79 PF13512: TPR_18" amino acids 45 to 185 (141 residues), 99.2 bits, see alignment E=3.8e-32 PF13525: YfiO" amino acids 48 to 253 (206 residues), 206.1 bits, see alignment E=7.9e-65 PF13174: TPR_6" amino acids 86 to 116 (31 residues), 15.2 bits, see alignment 4.2e-06

Best Hits

KEGG orthology group: K05807, putative lipoprotein (inferred from 45% identity to sml:Smlt3748)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>LRK53_RS05040 outer membrane protein assembly factor BamD (Rhodanobacter sp000427505 FW510-R12)
MRPTIDSPTLPMPKLPVLKVLVVLALVVSMSACSMFKSKRDTIDTMPLVALYDNAHASLQ
NTDYAAATKAYQRLIARFPSGEYNEQAQLEMAYAQYKDNQPDDASSTVNRFIKTYPANKH
VDYAYYLRGLINFDRTSGMIDRYINRKGSQARRDQGYNLQSFDDFSELSRRFPDSAYTAD
ARQRMIYLRNILAQYEINVAEFYLRNKAYIAAADRAQYVIEHYQQAPQTGDALAILSRSY
LALDQKTLADQSRQVLALNYPGHPYLTDAKWPHAPSTLRKMVPFSGHH