Protein Info for LRK53_RS04865 in Rhodanobacter sp000427505 FW510-R12

Annotation: APC family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 92 to 121 (30 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 367 to 392 (26 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details amino acids 444 to 464 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 17 to 451 (435 residues), 158.7 bits, see alignment E=2.3e-50 PF00324: AA_permease" amino acids 29 to 462 (434 residues), 105.1 bits, see alignment E=3.9e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>LRK53_RS04865 APC family permease (Rhodanobacter sp000427505 FW510-R12)
MATTQAAKNEPGLRRVLGTWDLVLFNIAAIVALRWLSMAAQVGPSSLVLWLLGLIGFFIP
LALAVLELSSRVPGQGGLYLWSKTAFGDMHGFIAGWTYWVSNLVYFPFALLFSAGIFLHV
GGDRWLAHAGDSGYHLVYCLTVLWAATGLGIFGLERVKWLQNIGGIATWSAAALILAAGA
VATYRLGQATTITAANVMPDFGKLATFSTFATIALAFQGLELGLILGGEIRDPRRQIPRA
TLISCVVIAAIYIAGTASLLIALPASTIDIIAGIPQALSAIGERIGLPMFGPLTAGLVTI
GTIGSISAWITGTARLPFVVGVDRYLPAALGRLHPRYGTPHVALITQGILTSLVLTAALS
GSSIHEAYIILVDMTAIMSLLPLLYILLAFPLLRHRAAGRNEGVNLSPGGTLGCWLVGLT
GFTVTLLAIVTSMIPPADNSSPGLFLLKVVGGSVLLIGVGLMFYRRGQQQAGQVSPNSWP
DIPGETADRQNPACPEQADAE