Protein Info for LRK53_RS04840 in Rhodanobacter sp000427505 FW510-R12

Annotation: DedA family protein/thiosulfate sulfurtransferase GlpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 36 to 44 (9 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 114 to 121 (8 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 165 to 190 (26 residues), see Phobius details PF09335: VTT_dom" amino acids 31 to 156 (126 residues), 44.2 bits, see alignment E=2.7e-15 PF00581: Rhodanese" amino acids 208 to 303 (96 residues), 42.7 bits, see alignment E=6.8e-15

Best Hits

KEGG orthology group: None (inferred from 50% identity to rsl:RPSI07_mp0352)

Predicted SEED Role

"Rhodanese-related sulfurtransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>LRK53_RS04840 DedA family protein/thiosulfate sulfurtransferase GlpE (Rhodanobacter sp000427505 FW510-R12)
MAHEIIALIAEYGVLLVFLNVLLTQLGAPLPAVPTLVVAGALAAGGQVAPAGAIGAAVAG
AVLGDLAWFTAGRRYGAGVMRLLCRISLSPDSCVARSELHFQRWRGGVLLIAKFVPGLST
VSSSLVGAMGLRLPVFALFDGLGSLWWATLAVGLGYLFAAQVDSLLATIASAGTLAIELM
AGLLTLYVLLRWWRRQRLLRTLRMARISVDELYREIADGHAPVVVDVRPAQTRQLDTRVV
PGALLVDDGGLDQLLHGIPLDRELVVYCNCPNEVSAARAAKLLMAQGYRRVRPLQGGLEA
WDAAGYGVERLPETAAATSPPDGARA