Protein Info for LRK53_RS04830 in Rhodanobacter sp000427505 FW510-R12

Annotation: CopD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details PF03653: UPF0093" amino acids 1 to 148 (148 residues), 104.6 bits, see alignment E=2.9e-34

Best Hits

KEGG orthology group: K08973, putative membrane protein (inferred from 53% identity to xac:XAC1402)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>LRK53_RS04830 CopD family protein (Rhodanobacter sp000427505 FW510-R12)
MYLLIKTLHLLFVMAWVASVFYLPRILVNIAEAGDELTVQNRLQLMGRRLYAFGNFMFCL
MLLFGLALWEGWRIWPRQLPDVTSSTYWIDTKLGLVAVLLVYFMWVGHLLKLNTEGGALP
SSKSLRWLNELPVILVVLTIYLVVDKPF