Protein Info for LRK53_RS04825 in Rhodanobacter sp000427505 FW510-R12

Annotation: IS1595 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF12760: Zn_ribbon_IS1595" amino acids 22 to 68 (47 residues), 43.8 bits, see alignment 2.1e-15 PF12762: DDE_Tnp_IS1595" amino acids 132 to 279 (148 residues), 111.4 bits, see alignment E=3.9e-36

Best Hits

KEGG orthology group: None (inferred from 71% identity to xcc:XCC2107)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>LRK53_RS04825 IS1595 family transposase (Rhodanobacter sp000427505 FW510-R12)
MAMNLVQFQPGLSMVEFMQQYGTEAKCYRALYRSRWPQGFRCPACDERRRCRFRRGAQVY
YQCRACGHRTTLLSGTILQATKLPLRTWMLAIHLLTSTKTDMAALELMYKAAWRVKHKIM
RAMAEREAPRHLSGFVQIDDAYLGGKFNGGKPGCGSPNKQTFLIAVETDVGLEHPAHAVI
EQVRGFDDESIKDWQARYLAPDAEVFRDGLYCFRRVADAGHAHTVLETTGGRAACQVRGA
RWVNVLLGNVKRAISGSYHAIRQGKYARRYLAEAAYRFNRRFRLREMLPRLARAMMPCRP
HAEPVLRMASNFHG