Protein Info for LRK53_RS04765 in Rhodanobacter sp000427505 FW510-R12

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 317 to 336 (20 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details PF01926: MMR_HSR1" amino acids 75 to 186 (112 residues), 61.3 bits, see alignment E=2.4e-20 PF02421: FeoB_N" amino acids 75 to 195 (121 residues), 36.2 bits, see alignment E=1.1e-12 PF04548: AIG1" amino acids 76 to 149 (74 residues), 33.4 bits, see alignment E=7.3e-12 PF05128: DUF697" amino acids 273 to 431 (159 residues), 91.3 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: K06883, (no description) (inferred from 41% identity to dno:DNO_0576)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>LRK53_RS04765 GTP-binding protein (Rhodanobacter sp000427505 FW510-R12)
MARGTLWLRLRGWLGPGRHVTAPPPRGSTGPTQVADSLHALLDDPTIPAAVRGELAGDFA
RIEAMLDRLERGELHVAVFGRVSTGKSALGNALLGREAFAVGVLHGTTTDAEHVPLDEAQ
HDGLVLIDTPGINELDGEARERLAFEVAEVSDLVVFVCDGDLTREELDALKTLAATQRPL
LLALNKADRYGRDELDSLLQHLRLRVAGLVRAEDVLAVAAHPAAQRVVEVDARGHEQVRE
QPRTPDVAALRERLLAIAAREGKTLSAINAGLYAGRLTDQVSARIAQTRQAVAAKLIRHY
CLAKGVAVALNPIPVADLLAAAGLDAAMVVQLSRVYGLPLTRAESGRLVAVISAQLAALM
GAIWGMQLVASALKGMSAGLSVVVTAAAQGALGWYATVLIGRAAERYLIAGKSWGEAGAK
RAVADIVASLDRDSILREAREEILRRLRNPGATR