Protein Info for LRK53_RS04665 in Rhodanobacter sp000427505 FW510-R12

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 TIGR00484: translation elongation factor G" amino acids 1 to 707 (707 residues), 881.9 bits, see alignment E=2.8e-269 PF00009: GTP_EFTU" amino acids 10 to 298 (289 residues), 213.3 bits, see alignment E=7.2e-67 TIGR00231: small GTP-binding protein domain" amino acids 11 to 182 (172 residues), 99.6 bits, see alignment E=1.6e-32 PF22042: EF-G_D2" amino acids 326 to 407 (82 residues), 45.5 bits, see alignment E=2e-15 PF03144: GTP_EFTU_D2" amino acids 340 to 406 (67 residues), 57.4 bits, see alignment E=4.9e-19 PF14492: EFG_III" amino acids 420 to 494 (75 residues), 102.9 bits, see alignment E=2.4e-33 PF03764: EFG_IV" amino acids 495 to 611 (117 residues), 132.8 bits, see alignment E=1.6e-42 PF00679: EFG_C" amino acids 616 to 701 (86 residues), 92.7 bits, see alignment E=3.5e-30

Best Hits

KEGG orthology group: K02355, elongation factor G (inferred from 64% identity to rce:RC1_3537)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (709 amino acids)

>LRK53_RS04665 elongation factor G (Rhodanobacter sp000427505 FW510-R12)
MARKKPLPLYRNIGIIAHIDAGKTTTTERILYYTGRKHQIVDVHDTKDGKGSTTTDYMEQ
ERKRGITIQSAAVTAEWKGHQINVIDTPGHVDFTIEVNRSLRVLDGAVVVFDGVAGVEPQ
TETNWRLADQYKVPRLCYVNKMDRIGANFAYCVQGIRERLGANALLCQVPLGSSDEFVGM
ADLVAGVGYLWASDDKDSVWETVPLEQLKDRLTFGASADNAWIADLPKLRQDLLETALAL
DDDAFERLLNTGGFDPAVLKQCIRKGTVTGALVPVLCGSSYKNKGVQQLLDAVVDYLPYP
GENGGIALVDEDGHVVGEQAVTDDAPARALAFKVINDQFGTLTFCRIYSGVIKKGDTLLN
VTRGRKERVGRIVEVQADHTREIDEVRAGDICAFVSMKDTETGDSLSDPAHPALLERMRF
PDPVISVSVEPKNRDDVDKLSSALYKMVKADPSLKLEVDQETGQTVLKGMGELHLEVTLD
RMRTELGVEANMGKPRVSFREAFGKTVEHTYTHKKQTGGSGQFAEVTMIFEPGEAGSGVV
FSDEVVGGRVPREYIPAVEHAIKVEAQEGQVAGYEVVDFAARLIDGKYHDVDSSALAFEI
AARQCFREAQKLSSPKLLEPIMRLEVVMEADYLGDVIGDINRRRGTVSDQGHKGSSAFVQ
GFVPLAEMFGYINFLRSATRGRGTFSMEFDHYQEVPAGMVEKLMEKEVK