Protein Info for LRK53_RS04525 in Rhodanobacter sp000427505 FW510-R12

Annotation: M48 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details PF01435: Peptidase_M48" amino acids 105 to 317 (213 residues), 109.2 bits, see alignment E=1.1e-35

Best Hits

Predicted SEED Role

"Heat shock protein HtpX / FIG017973: domain of unknown function"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (627 amino acids)

>LRK53_RS04525 M48 family metallopeptidase (Rhodanobacter sp000427505 FW510-R12)
MDFFAQQARVRSSSRRLVLLFALAVAAIVAAIDAAVWLAFGRYPADGEPAASNLPLLLVS
SAAVVVGIGLGSLFRSMSLSGGGKAVAGSVGAVAVPPDTGDPQLRRLRNVIEEVAIASGV
PVPDIYLMADEAGINAFAAGYSSSDAAVCVTRGCLDKLSRDELQGVLAHEFSHVLNGDMR
LNIRLMGLLFGILVLAVAGRRLLQFGGRGSRRGGSQVLLIGVALMVVGYIGYFFARLIQA
AVARSREALADASAVQFTRQTDGLAGALKKIAIDVEGSALQVANRQEVAHMLFGEAGRFN
ALFATHPPLLERIRALEPGFNEADLTRMAAGMPREAASPPPVRANAAAASSGMPGLPLPP
IPTGVLAGGVAAAAPAFQRAAAVQQAIPPSLSVAVQQPESALTVMLALALSLEAELQPAQ
RRIVADAFGDDVQRAVQAQASTLAALTPVARLPLVSLAFPALRQLPDGRQQTLLRALDDL
VKVDGRVDINEYCLARLLRIQLSEARAPRRAPVDGVKKLPAVRDSVVLVCTIVAAAGCSD
EAGARRAWLFAMQQAFPGEAIEWTPPPAAWQAPFERALDDLDGLSPMAKERVIQALLRAI
RADGQVSVEEVELLRVICASLHSPLPL