Protein Info for LRK53_RS04185 in Rhodanobacter sp000427505 FW510-R12
Annotation: dihydrolipoyllysine-residue acetyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Predicted SEED Role
"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
- pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
- pyruvate fermentation to acetate II (3/3 steps found)
- pyruvate fermentation to acetate V (3/3 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
- pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glycolysis / Gluconeogenesis
- Pyruvate metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.12
Use Curated BLAST to search for 2.3.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (471 amino acids)
>LRK53_RS04185 dihydrolipoyllysine-residue acetyltransferase (Rhodanobacter sp000427505 FW510-R12) MADLKEARVPDIGHADVPVIEVLVKAGDRVEKEQSLITLESDKATMEVPAPFAGTVKEMK LKVGDEVSEGAVIALIEIDSHKEADGAAVSASPSPAAGEGRGEGAPEAVKPPAAAPAPAP APAPAPAPAEPKPAPIAGQGVQPGNAPEGDMPPRARPPMDASIVMPGDAPYASPAIRAFA RELGVDIQQVKGSGRGGRIQREDVSTYVKHALASGARPVAGAAASVGGLNLLPWPKVDFA KFGEIEEKPLTRIQKISGANLSRNWAMIPHVTQHEDADITEMEAFRKQLGAENKDLKISP LVFQIKAVVAALKAFPQFNASLDESGEKLILKKFFHIGIAVDTPDGLVVPVIRDCDKKGL LDLARDLAEISKKAREKKLGPAEMSGGCFSISSLGGIGGTYFTPIVNAPEVAILGVSKSV TKPVWNGKEFAPRLILPLSLSYDHRVIDGALAARFASFLANQLGDIRRLLL