Protein Info for LRK53_RS03810 in Rhodanobacter sp000427505 FW510-R12

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF05690: ThiG" amino acids 6 to 251 (246 residues), 334.8 bits, see alignment E=1.5e-104

Best Hits

Swiss-Prot: 72% identical to THIG_OCHA4: Thiazole synthase (thiG) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 72% identity to sno:Snov_2601)

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>LRK53_RS03810 thiazole synthase (Rhodanobacter sp000427505 FW510-R12)
MDALHLYGETLVSRLLLGSAHYPSPACLAEAVAASGCEVVTVSLRRESAAQRSGQDFWAQ
VRALGVRVLPNTAGCHSVREAVTTAQMARELFGTRWIKLEVIGDDDTLRPDVFGLVEAAR
VLAEEGFAVFPYTTDDLGVAGRLLDAGCRVLMPWAAPIGSGRGLSHPHALRTLRAHFPEV
PLVIDAGLGLPSQAAAAMELGYDAVLLNTAVARAGDPVAMARAFAQAVDAGRTAWRAGPI
EPRDLAAPSTPVSGRAELA