Protein Info for LRK53_RS03740 in Rhodanobacter sp000427505 FW510-R12

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF22694: CtpB_N-like" amino acids 62 to 112 (51 residues), 44.4 bits, see alignment 4.7e-15 TIGR00225: C-terminal processing peptidase" amino acids 78 to 392 (315 residues), 324.7 bits, see alignment E=3e-101 PF00595: PDZ" amino acids 122 to 193 (72 residues), 33.7 bits, see alignment E=9.6e-12 PF13180: PDZ_2" amino acids 127 to 205 (79 residues), 44.6 bits, see alignment E=3.7e-15 PF17820: PDZ_6" amino acids 141 to 193 (53 residues), 38.3 bits, see alignment 2.3e-13 PF03572: Peptidase_S41" amino acids 225 to 388 (164 residues), 172.6 bits, see alignment E=1.3e-54

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 49% identity to mca:MCA2533)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>LRK53_RS03740 S41 family peptidase (Rhodanobacter sp000427505 FW510-R12)
MRLSPSGAPLGLAALLLAAPFLLAAPKLCAQNAPASPAAPVELPAATSSAAVPAAAGTVD
QVDLDDIRNFSRVYEVVRQAYVEKVDDKTLMKAAITGMLSGLDPHSEYLDKEGLTQLNED
TTGQYSGLGIEVLQVDGGLRIVSPIDDTPAARAGIKPGDSIVKINGIVVDAQNVDGMFKE
LRGKPGSKVDLTIVHQNSDKLIDLHLVRENIAISSVKVRELEPGYAYVRISQFQDDTAGD
LERKLGQLIAKNGPPKGAVLDLRNNPGGLLTAAVGVSDDFLDVGTIVTTRGRLQDANMSF
KAHPGDQLGGAPMVVLTNNGTASAAEIVSGALKDNHRALIMGQRTFGKGVVQTVLPLDAD
HAVKITTARYYTPNGTSIQAEGIKPDIALAELTVNPSDHGPVLISSEADLPNHLANEKAQ
AGTNINDDGSAADAKLATSDYALAQALNVLKGMALRQPATVRR