Protein Info for LRK53_RS03735 in Rhodanobacter sp000427505 FW510-R12

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 TIGR02392: alternative sigma factor RpoH" amino acids 17 to 284 (268 residues), 406.2 bits, see alignment E=7.7e-126 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 52 to 281 (230 residues), 113.1 bits, see alignment E=1e-36 PF04542: Sigma70_r2" amino acids 56 to 125 (70 residues), 70.2 bits, see alignment E=1.5e-23 PF04545: Sigma70_r4" amino acids 230 to 281 (52 residues), 54.7 bits, see alignment 8.9e-19

Best Hits

Swiss-Prot: 59% identical to RPOH_PROMI: RNA polymerase sigma factor RpoH (rpoH) from Proteus mirabilis

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 74% identity to sml:Smlt4258)

MetaCyc: 58% identical to RNA polymerase sigma factor RpoH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>LRK53_RS03735 RNA polymerase sigma factor RpoH (Rhodanobacter sp000427505 FW510-R12)
MSQALAITPSNLPSVVGSLDAYISAVHRIPVLSQEEEQALSRDYLEEANLAAAKKLVMSH
LRFVVHVARGYSGYGLQLADLIQEGNIGLMKAVKRFDPDQGVRLVSFAVHWIRAEMHEFI
LKNWRIVKVATTKAQRKLFFNLRKSKKRLGWMNAAEVSTVAKDLGVPEATVREMESRLSG
RDIGFEAPVDADDDAKPAPAAFLVDDGADPYQNVADEDYADNQMETLNDALAHLDPRSRD
IIQRRWLDDSSKATLQDLADEYGVSAERIRQIEANAMKKMRGLFATAA