Protein Info for LRK53_RS03705 in Rhodanobacter sp000427505 FW510-R12

Annotation: thioredoxin TrxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF00085: Thioredoxin" amino acids 6 to 106 (101 residues), 120.2 bits, see alignment E=1.1e-38 TIGR01068: thioredoxin" amino acids 9 to 107 (99 residues), 130.5 bits, see alignment E=1.1e-42 PF13098: Thioredoxin_2" amino acids 19 to 103 (85 residues), 42 bits, see alignment E=3.2e-14 PF00578: AhpC-TSA" amino acids 21 to 80 (60 residues), 28.5 bits, see alignment E=3.8e-10 PF13905: Thioredoxin_8" amino acids 22 to 67 (46 residues), 38.9 bits, see alignment E=2.8e-13 PF13728: TraF" amino acids 25 to 104 (80 residues), 31.9 bits, see alignment E=3.6e-11

Best Hits

Swiss-Prot: 64% identical to THIO_PSEAE: Thioredoxin (trxA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 69% identity to mei:Msip34_2320)

MetaCyc: 62% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>LRK53_RS03705 thioredoxin TrxA (Rhodanobacter sp000427505 FW510-R12)
MSDLITHVNDDAFEQQVLKSETPVLLDFWAEWCGPCKAIAPMLDELAQQYEGKLRVVKVN
IDQNQQTPRAYGVRGIPTLMVFKNGKVEATQIGAVSKGQLTQMIDKAI