Protein Info for LRK53_RS03635 in Rhodanobacter sp000427505 FW510-R12

Annotation: 50S ribosomal protein L33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01023: ribosomal protein bL33
  • amino acids 1 to 55 (55 residues), 86.2 bits, E=7.2e-29
• PF00471: Ribosomal_L33
  • amino acids 8 to 53 (46 residues), 66.9 bits, E=8e-23

Best Hits

Swiss-Prot: 82% identical to RL33_XANC5: 50S ribosomal protein L33 (rpmG) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K02913, large subunit ribosomal protein L33 (inferred from 82% identity to xoo:XOO4558)

MetaCyc: 71% identical to 50S ribosomal subunit protein L33 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L33p" in subsystem Ribosome LSU bacterial

Protein Sequence (55 amino acids)

>LRK53_RS03635 50S ribosomal protein L33 (Rhodanobacter sp000427505 FW510-R12)
MAKTANDKIRMISSAGTGHFYTTQKNKKNTPEKFEFKKYDPVVRKHVIYKEGKIK