Protein Info for LRK53_RS03585 in Rhodanobacter sp000427505 FW510-R12

Annotation: tryptophan 7-halogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 350 to 368 (19 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details PF01494: FAD_binding_3" amino acids 9 to 345 (337 residues), 80.1 bits, see alignment E=6.7e-26 PF04820: Trp_halogenase" amino acids 10 to 82 (73 residues), 29.4 bits, see alignment E=1.3e-10 amino acids 102 to 357 (256 residues), 57.7 bits, see alignment E=3.6e-19 PF12831: FAD_oxidored" amino acids 10 to 174 (165 residues), 36 bits, see alignment E=1.8e-12 PF00890: FAD_binding_2" amino acids 10 to 42 (33 residues), 21.2 bits, see alignment (E = 5.2e-08) PF13450: NAD_binding_8" amino acids 13 to 46 (34 residues), 29.2 bits, see alignment 3.2e-10

Best Hits

KEGG orthology group: None (inferred from 54% identity to xom:XOO_4071)

Predicted SEED Role

"FIG022199: FAD-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>LRK53_RS03585 tryptophan 7-halogenase (Rhodanobacter sp000427505 FW510-R12)
MAELEVEQCDVAVIGGGPGGSTAATLLARRGYKVIALEKARHPRFHIGESLLPMNLPVFE
RLGVLGKVRELGVFKRGADFETDDACGYNVYAFARAIGHSPPHAYQVWRQDLDRMLYQHA
RGCGADAREGHEVLRVEQRGPRESRLEVRTDDGRDYAIRARYVVDASGRDALLATKMKLR
RKSARHQSAAIFGHFRGADRRDGEDAGNVSIYRFAHGWMWMIPLPDEVMSVGAVCRPDYL
KQRKGRTVEFLLDTLRLNPALWQRVERAGLIGNEVHVTGNYSYDATRMGGPGWVLVGDAF
AFLDPVFSSGVYLAMDGAERVAELVDAALREPRCERALLRRLERRQRKGMARFAFFIHRF
NGPVMRQMLRSPRNTWQLEQAVISMLAGDLFDTPKVLWRLQLFKLVYAILCLHDWRRSRA
ERRYRLAQARAPVGRE