Protein Info for LRK53_RS03535 in Rhodanobacter sp000427505 FW510-R12

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 33 (5 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF00892: EamA" amino acids 12 to 142 (131 residues), 86.8 bits, see alignment E=8.1e-29 amino acids 155 to 287 (133 residues), 69.2 bits, see alignment E=2.3e-23

Best Hits

KEGG orthology group: None (inferred from 61% identity to bte:BTH_I1368)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>LRK53_RS03535 DMT family transporter (Rhodanobacter sp000427505 FW510-R12)
MDTVERLDGRALTAIAIALLTWSSAYAAIAYALPAFTPGEVAFARLLIGSLCFAALLWVK
RVPLPARRDWPLLALLGVLGLTVYHLCLNYAETRIASGTASILISLVPAATAAVSALWLR
ERLTLRTWIGLAVALLGTVLVVLASGQRVEMDPHALLVLVCVAVSAIFFVGQKALFARNS
MLGVTAFAFFAGTLAALPFGWHLPQALRVASWAHIGALLWLGIAPTFVGYLAWNMAVNRA
SASRVSSFIYLSPPIALLIGWLWLHEVPNALILVGGAVTIGGVVLANARRRPAPPVAAAA
PACARTCEQA