Protein Info for LRK53_RS03515 in Rhodanobacter sp000427505 FW510-R12

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 3 to 201 (199 residues), 54.1 bits, E=2.3e-18
• PF13460: NAD_binding_10
  • amino acids 7 to 149 (143 residues), 38.1 bits, E=2.4e-13
• PF13781: DoxX_3
  • amino acids 321 to 420 (100 residues), 59.6 bits, E=5.9e-20

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• UDP-sugars interconversion (4/9 steps found)
• stachyose degradation (2/7 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Protein Sequence (430 amino acids)

>LRK53_RS03515 SDR family oxidoreductase (Rhodanobacter sp000427505 FW510-R12)
MRVLVTGAYGFIGAHIVAALTAGGHEVVCAVRGARVDTRFPGLRAIACDMARDLRCEDWL
PRLDGIDTVVNCVGILRERGADTYAAVHEQAPLALFQACVRRGVRRAIQISALGDPADGD
FVASKHRGDAALAALKLDWLVLRPSLVYSARGSYGGSSLLRALAALPGALPLPAGGTQRV
QPIAAEDVGVAVVAALARPDVAHRIIELVGPEAMPLRDYLLAWRRWLGFGRVRILSVPLP
LARGVAALGEWLGHGPLGRTMLRMLERGNVGAADAVTRLRDTLGLSPRSLQRALNEAPSQ
VQDRWHARLYCWLPLLRVLLALLWLGSGVVGWTTSAHEMQALAAGSPLGGEAALWLTRLT
ASVDLSLGALCLLRWRPRPVLGAMLAMLLGYTLGVGLLWPAQWLAPFGGLLKNLPLIAAL
AILLATDERR