Protein Info for LRK53_RS03470 in Rhodanobacter sp000427505 FW510-R12

Annotation: tRNA 2-thiocytidine(32) synthetase TtcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF01171: ATP_bind_3" amino acids 41 to 205 (165 residues), 53.2 bits, see alignment E=1.6e-18

Best Hits

Swiss-Prot: 74% identical to TTCA_STRMK: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 74% identity to psu:Psesu_2941)

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>LRK53_RS03470 tRNA 2-thiocytidine(32) synthetase TtcA (Rhodanobacter sp000427505 FW510-R12)
MSVQFEIPCPSAAESGKLARRLRRQVGQAIGDFGMIEDGDKVMVCLSGGKDSHTLLDLLL
QLQAKAPVRFELIAVNLDQKQPGFPAHVLPEYLKSCGVPFHIIEQDTYSTVTRVIPAGKT
LCSLCSRLRRGALYTWAAANGITKIALGHHRDDILATFFLNLFYQAQLKAMPPKLRSDDG
RHVVIRPLAYCRESDIAEYAAQQRFPIIPCNLCGSQDNLQRQAVQRMLAEWERQQPGRSE
NIFRALGHVSPSHLTDRTLFDFALGVAAVWPTDATDAAAAPGHSSHPPVE