Protein Info for LRK53_RS03415 in Rhodanobacter sp000427505 FW510-R12

Annotation: tRNA (cytidine(34)-2'-O)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF00588: SpoU_methylase" amino acids 2 to 142 (141 residues), 100.8 bits, see alignment E=3.7e-33

Best Hits

Swiss-Prot: 59% identical to TRML_ECOL6: tRNA (cytidine(34)-2'-O)-methyltransferase (trmL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03216, RNA methyltransferase, TrmH family, group 2 [EC: 2.1.1.-] (inferred from 70% identity to pap:PSPA7_5861)

MetaCyc: 59% identical to tRNA (cytidine/uridine-2'-O)-ribose methyltransferase (Escherichia coli K-12 substr. MG1655)
2.1.1.M27 [EC: 2.1.1.M27]; RXN-11860 [EC: 2.1.1.M27, 2.1.1.207]; 2.1.1.207 [EC: 2.1.1.M27, 2.1.1.207]

Predicted SEED Role

"tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207)" (EC 2.1.1.207)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.207 or 2.1.1.M27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>LRK53_RS03415 tRNA (cytidine(34)-2'-O)-methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MLHVILFRPEIPPNTGNVIRLCANTGAALHLIRPLGFALDDARLRRAGLDYHEYASVAVY
DDLASCLDAIGAPRVFAFSTRGHVAHVDARFADGDALLFGCETAGLPGEVLESIPAERRL
RLPMCPDSRSLNLSNTVAVAVYEAWRQLGFVGAGNRESRIG