Protein Info for LRK53_RS03330 in Rhodanobacter sp000427505 FW510-R12

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase QueF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR03138: queuine synthase" amino acids 4 to 274 (271 residues), 389.2 bits, see alignment E=6e-121 PF14819: QueF_N" amino acids 15 to 124 (110 residues), 150.3 bits, see alignment E=2.6e-48 PF14489: QueF" amino acids 188 to 261 (74 residues), 71.7 bits, see alignment E=5e-24

Best Hits

Swiss-Prot: 61% identical to QUEF_BURCC: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Burkholderia cenocepacia (strain MC0-3)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 63% identity to bpt:Bpet3252)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>LRK53_RS03330 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (Rhodanobacter sp000427505 FW510-R12)
MSTPEHSPLGKDTIYADRYDPRLLFPIPRADKRAEIGIAESLPFHGVDVWNAYELSWLDL
RGKPQVAMAEFRVPAASPHIIESKSFKLYLNGFAQERLADAATLVAILTHDLSAAAGAVV
GVHLRDARADALPVVDLDGHLLDDQDIAIDRYGPPDADFLQADSAATPVAETLLSHLLRS
NCPVTGQPDWGSVQIAYRGAPIDHAGLLRYLVSFRTHNEFHEQCVERIFVDLTQRCAPRQ
LTVYARYTRRGGLDINPFRSSAPATPGNPRTVRQ