Protein Info for LRK53_RS03265 in Rhodanobacter sp000427505 FW510-R12

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 42 to 67 (26 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 135 to 166 (32 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 333 to 351 (19 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 85 to 217 (133 residues), 107.6 bits, see alignment E=6.4e-35 PF24858: AGMP_C" amino acids 303 to 369 (67 residues), 32.5 bits, see alignment E=7.1e-12

Best Hits

KEGG orthology group: None (inferred from 50% identity to pba:PSEBR_a5459)

Predicted SEED Role

"Sterol desaturase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>LRK53_RS03265 sterol desaturase family protein (Rhodanobacter sp000427505 FW510-R12)
MNTQELIITWATPVFFLLIGIELLVAKLRGRDAYASNDAINSIGLGVISQLVGVFSKLLT
IGIYAWCVEHLALFTLPENSLGVWIGALLLYDFCYYWLHRMGHQVNILWAAHVVHHQSER
YNLSTALRQTGSGALLGWLFYLPLALLGVPLKVFVVVALIDLLYQFWVHTEQIGKLGWFD
RVFCSPSNHRAHHAVNDRYLDRNYGGILIVWDRLFGSFVEEDANDPPVYGTRSPLRSWNP
LWANAEVYWKTAQDAWRARRWRDKLLVWLKPPGWRPADVAARYPRPDFVMPGERFDPPLS
RPLKLYVLAQFALLLGMTTQFLGMAGAASLPTLLLYALYLVASLCVIGALMEGRRWAWWA
EGIRVLATATVPLLSGRWFGLAHLDGHVALAIAVVFGLSAVALPWLGGMRRPSSLRHDVA
TG