Protein Info for LRK53_RS03200 in Rhodanobacter sp000427505 FW510-R12

Annotation: UbiA family prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details PF01040: UbiA" amino acids 21 to 276 (256 residues), 91.6 bits, see alignment E=2.5e-30

Best Hits

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 64% identity to gpb:HDN1F_13890)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>LRK53_RS03200 UbiA family prenyltransferase (Rhodanobacter sp000427505 FW510-R12)
MRRFLALSRSFHGVLDIAMPGFVALLWLGHFPSWRVLALSLATALAGYTAIYALNDLIGV
KDDKEKVAGGITPGYAVEASAMRYPLAQNLISMKGALAWFGCWFALAVLGTWLLNPRILV
IVFAAAALEVVYVKLLKVTWWRTVVSGLVKSAGPIAAVFAVIPEPSWSGLLGLLAWLMLW
EIGGQNIPADWNDIEEDRRIGARTIPLVFDLRTAGVLVVVCLGLAVLASALLPRLSPLDG
GWPFQLAIVAAGAGLLLLPAIRLARTLDGRQAARLFDRASLYPLALLAIVTVFVLIR