Protein Info for LRK53_RS02825 in Rhodanobacter sp000427505 FW510-R12

Annotation: cytochrome c4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00034: Cytochrom_C" amino acids 56 to 120 (65 residues), 29.7 bits, see alignment E=1.3e-10 amino acids 136 to 233 (98 residues), 35.7 bits, see alignment E=1.8e-12 PF13442: Cytochrome_CBB3" amino acids 153 to 231 (79 residues), 22.3 bits, see alignment E=1.4e-08

Best Hits

KEGG orthology group: None (inferred from 38% identity to spc:Sputcn32_3908)

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>LRK53_RS02825 cytochrome c4 (Rhodanobacter sp000427505 FW510-R12)
MTSRTSLLCMFLFGAGLVAGAGASEPPHTHIPPTKVVDLRRLQPVSGDAAAGASKATVCV
ACHGARGLSIAPNFPNLAGQSATYLYVQMKEFHEGQRIGTVMNGQSATLSDADARDLASY
YAAMAPRPAGRTDAASRGAQLYLAGDPAKGIPPCQGCHGPDGAGPRPHASSAPQPPWAAF
PRLRGQSGQYLAHELHDFKTGARAGTSNAKVMQDAAAMLDDEDVQALSVYLEAL