Protein Info for LRK53_RS02815 in Rhodanobacter sp000427505 FW510-R12

Annotation: DmsE family decaheme c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13435: Cytochrome_C554" amino acids 97 to 146 (50 residues), 15.1 bits, see alignment 1.2e-05 TIGR03508: decaheme c-type cytochrome, DmsE family" amino acids 104 to 371 (268 residues), 257.7 bits, see alignment E=1.2e-80 PF22678: Cytochrom_c_NrfB-like" amino acids 141 to 231 (91 residues), 28.2 bits, see alignment E=6.5e-10 PF14537: Cytochrom_c3_2" amino acids 195 to 282 (88 residues), 30 bits, see alignment E=1.7e-10 PF09699: Paired_CXXCH_1" amino acids 202 to 236 (35 residues), 28 bits, see alignment 4.3e-10 amino acids 244 to 286 (43 residues), 44.6 bits, see alignment 2.7e-15 amino acids 293 to 330 (38 residues), 43.8 bits, see alignment 5.1e-15 TIGR01905: doubled CXXCH domain" amino acids 244 to 285 (42 residues), 34.4 bits, see alignment 1.6e-12 amino acids 293 to 329 (37 residues), 38.8 bits, see alignment 6.5e-14

Best Hits

KEGG orthology group: None (inferred from 52% identity to nhl:Nhal_1192)

Predicted SEED Role

"Decaheme cytochrome c MtrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>LRK53_RS02815 DmsE family decaheme c-type cytochrome (Rhodanobacter sp000427505 FW510-R12)
MRAISLLLAVVLCTALSAGVMLLGARDVQAQQAGGSAAPDPHAAPAGGLSQGDIASMLPA
TDMGAGTARAGNPHPASMSDSPATPFDAASIPANPLAPNADAIGAKSCVACHTQENVQAS
HTLHVASFRAGAANTGPQAACESCHGPGSAHAKNPTAPGLIIGFTHDAKTSPQTQVGVCL
ACHAGGARQHWIGSIHQNRGLSCTDCHNPMARLSPEGVLTKSSINEVCATCHQDIRAKFN
RRSHMPLPEGQMACTDCHNPHGSITKPLLKTDTVNQTCYACHAEKRGPFLFEHAPVRANC
LNCHDAHGSNQQTLLVAPIPMLCQQCHTVTRHPNDLQSAANLGTGPFPDERLMGRGCLSC
HTNIHGSNNPSGPKFHK