Protein Info for LRK53_RS02660 in Rhodanobacter sp000427505 FW510-R12

Annotation: type II toxin-antitoxin system HipA family toxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF13657: Couple_hipA" amino acids 23 to 109 (87 residues), 28.1 bits, see alignment E=2.3e-10 PF07804: HipA_C" amino acids 185 to 395 (211 residues), 159 bits, see alignment E=1.3e-50

Best Hits

KEGG orthology group: K07154, (no description) (inferred from 51% identity to put:PT7_2173)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>LRK53_RS02660 type II toxin-antitoxin system HipA family toxin (Rhodanobacter sp000427505 FW510-R12)
MSARSETVLDVVLDDATLGPTMAIGSLRCERHGAGEAIGFAYHRDYLEQRRSVAIAPDLP
LVAGPSWPAREQALFGIFRDISPDRWGRMLMERREALEAREAKRRLRRLSEWDFLTGVDD
CTRMGALRLRRTEPPHAWVDERERSAPPATRLRELEAIARELGHEDAEERPEYARWLAQL
MAPGTSMGGARPKATFADEHGALWLAKFPAHDDRRDVGAWEYLAWRLARAAGLIVPDARL
LRFGRGYRSFTVRRFDRQGDSRRLYASTMTLTGRNDGEGGSYLDIAQAIQRHGDPGGIGD
DLAQLYRRIAFSILIGNRDDHLRNHGFLRTPDGWRLAPAFDINPNPDKREHALAIDAHDP
SPRLANLRATHTFYRLDGTQAKAIEAEVRDAVAHWPAIATELKLPRTARDQLAALIGD