Protein Info for LRK53_RS02605 in Rhodanobacter sp000427505 FW510-R12

Annotation: type I-F CRISPR-associated endoribonuclease Cas6/Csy4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR02563: CRISPR-associated endoribonuclease Cas6/Csy4, subtype I-F/YPEST" amino acids 4 to 188 (185 residues), 181.1 bits, see alignment E=1e-57 PF09618: Cas_Csy4" amino acids 5 to 188 (184 residues), 206.1 bits, see alignment E=2.5e-65

Best Hits

Swiss-Prot: 50% identical to CAS6_PECAS: CRISPR-associated endonuclease Cas6f/Csy4 (cas6f) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 60% identity to ajs:Ajs_0484)

Predicted SEED Role

"CRISPR-associated protein, Csy4 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>LRK53_RS02605 type I-F CRISPR-associated endoribonuclease Cas6/Csy4 (Rhodanobacter sp000427505 FW510-R12)
MTTHYIDIRVIPDPESGPAQLLGALYDHLHIALVHQHRDGIGISFPGYGLNPRTLGTTLR
LHGSETDLQQLLATDWLKGMRDHVRTDSLAAAPAGAPHRTVQRKQFKTSAERLRRRRMHR
KSETAEQAQAAIPASMERRPKLPYVHLHSRSTGQPFCLFVAMGPLQPQVTPGNFNSYGFG
GATTIPWF