Protein Info for LRK53_RS02570 in Rhodanobacter sp000427505 FW510-R12

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 119 to 135 (17 residues), see Phobius details PF12146: Hydrolase_4" amino acids 54 to 151 (98 residues), 27.5 bits, see alignment E=3.8e-10 PF20408: Abhydrolase_11" amino acids 56 to 207 (152 residues), 28.7 bits, see alignment E=2.2e-10 PF00561: Abhydrolase_1" amino acids 67 to 148 (82 residues), 26.9 bits, see alignment E=7.3e-10 PF02129: Peptidase_S15" amino acids 71 to 148 (78 residues), 24.5 bits, see alignment E=4.2e-09

Best Hits

KEGG orthology group: K07018, (no description) (inferred from 67% identity to psu:Psesu_0050)

Predicted SEED Role

"Alpha/beta hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>LRK53_RS02570 alpha/beta hydrolase (Rhodanobacter sp000427505 FW510-R12)
MTPTELSTAPAGFPDIAASFTLDGPAGKLEAISDVAEAACARRGVAVICHPLTIEGGSMH
NKVVTMVERALRESGLDTVRFNFRGAGGSHGEYDKGQGEGEDLAAVVAWVRRMRPHDALW
LAGFSFGSYVSIANAVRLHADALVSVAPPVGRWPFDVIALPSCPWLIVQGEADEIVEPQA
VFDWVETLAHRPELVRMPETSHFFHRRLMDLRGAIKHAVQGWLPPKRHA