Protein Info for LRK53_RS02455 in Rhodanobacter sp000427505 FW510-R12

Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF02527: GidB" amino acids 29 to 203 (175 residues), 179.2 bits, see alignment E=5.4e-57 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 31 to 204 (174 residues), 170.6 bits, see alignment E=1.4e-54 PF05175: MTS" amino acids 60 to 140 (81 residues), 26 bits, see alignment E=6.8e-10

Best Hits

Swiss-Prot: 58% identical to RSMG_STRMK: Ribosomal RNA small subunit methyltransferase G (rsmG) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 61% identity to psu:Psesu_2850)

MetaCyc: 48% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>LRK53_RS02455 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (Rhodanobacter sp000427505 FW510-R12)
MTTRDALQARLEQGIAALGLSLPADAVSRLLDYQALLERWNAAYNLTAVRDPAEMVTRHL
LDSLAILPYVQGRTLADLGTGPGLPGIVLAIAAPGRKVLLVDSNGKKVRFLREAIRALKL
DGVRALQSRVEDVEGQFDCITARAFASLADMLGWGGHLLAPDGVWLAMKGKRPDEELPGI
PAGFVVRSTHELVVPGLPAERHLLQLGRAA