Protein Info for LRK53_RS02415 in Rhodanobacter sp000427505 FW510-R12

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 52 to 78 (27 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 245 (150 residues), 70.3 bits, see alignment E=9.2e-24

Best Hits

KEGG orthology group: K10190, lactose/L-arabinose transport system permease protein (inferred from 75% identity to psu:Psesu_1286)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>LRK53_RS02415 carbohydrate ABC transporter permease (Rhodanobacter sp000427505 FW510-R12)
MAAVALFPLLWMLSVSFMAPGEASALPPPLLPKHPSGTNYRELFVRAGMGRYLLNSVLVA
GAITALSLVFNLMAGYAFAKLRFAGRERLFQALLGALVIPAQVAMLPLFLLLKYLGLVNS
YAGVIAPALASVFGIFLVRQYARDIPDELLEAARIDGAGEWHIFARIVLPLLKPIIVTLA
IFSFLAAWNDFMWPLIVLTGQEHYTLPIGLASLAREHAQDSELMMAGSVVTVLPVLALFL
ALQRHYLQGLLLGSVKG